PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011698P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 228aa    MW: 26770.2 Da    PI: 10.7074
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011698P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.3e-141458147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G+ +W+ Ia++++ gR++  c++rw++ 
   MELO3C011698P1 14 RGHWRPAEDEKLRQLVQQHGPQNWNFIAEKLQ-GRSG-ICRLRWFNQ 58
                     899*****************************.****.9*****996 PP

2Myb_DNA-binding59.76.6e-1965108146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l++a+  +G++ W++Iar ++ gRt++ +k++w+ 
   MELO3C011698P1  65 RRPFTEEEEERLLEAHGIHGNK-WALIARLFP-GRTDNAVKNHWHV 108
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.226959IPR017930Myb domain
SuperFamilySSF466895.24E-2712106IPR009057Homeodomain-like
SMARTSM007173.0E-91361IPR001005SANT/Myb domain
PfamPF002491.8E-131458IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-231566IPR009057Homeodomain-like
CDDcd001678.91E-101757No hitNo description
PROSITE profilePS5129428.13760114IPR017930Myb domain
SMARTSM007176.3E-1664112IPR001005SANT/Myb domain
PfamPF002495.6E-1665107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-2267113IPR009057Homeodomain-like
CDDcd001676.11E-579107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MAGVAGDDAK SCPRGHWRPA EDEKLRQLVQ QHGPQNWNFI AEKLQGRSGI CRLRWFNQLD  60
PRINRRPFTE EEEERLLEAH GIHGNKWALI ARLFPGRTDN AVKNHWHVIM ARKQRQQSNN  120
NNLPTRKKIT SNYQQFLLHS KLISHSHGDG HGGGELFGRF WQPKIRNPNN RWDYNLNMFL  180
RSCYQNSFRS ENFRLNIRSK STIKFEILNE SVERKDAKFI DFLGVEQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141137107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818170.0LN681817.1 Cucumis melo genomic scaffold, anchoredscaffold00015.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445798.11e-148PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0A0LKW91e-111A0A0A0LKW9_CUCSA; Uncharacterized protein
STRINGSolyc04g064540.2.12e-65(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73410.15e-55myb domain protein 54